General Information

  • ID:  hor001140
  • Uniprot ID:  A0A7M7GA41
  • Protein name:  SIFamide
  • Gene name:  100578023
  • Organism:  Apis mellifera (Honeybee)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  RKPPFNGSIF
  • Length:  10
  • Propeptide:  MVSTRLVLAVVAALFVLAISVDAAYRKPPFNGSIFGKRSNTITDYEITSRAMSSVCEVVSETCNAWLSRQDSN
  • Signal peptide:  MVSTRLVLAVVAALFVLAISVDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7GA41-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001140_AF2.pdbhor001140_ESM.pdb

Physical Information

Mass: 132305 Formula: C55H83N15O13
Absent amino acids: ACDEHLMQTVWY Common amino acids: FP
pI: 11.65 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -62 Boman Index: -1869
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 39
Instability Index: 2495 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera